DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and plpr-1

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_496399.1 Gene:plpr-1 / 174710 WormBaseID:WBGene00011524 Length:396 Species:Caenorhabditis elegans


Alignment Length:256 Identity:60/256 - (23%)
Similarity:97/256 - (37%) Gaps:79/256 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PPTKRGFFCDDESLMYP---------YHENTVSPTLLHWLGLYLPLISLVVLESFLSHRKDMAPW 91
            |...|.|:|.|..|..|         |    ||..||:.|...:|.:.:::.|..          
 Worm    65 PYHHRVFYCRDVHLYKPNFVPEDFNVY----VSYPLLYTLAFTIPPLVILIGEVM---------- 115

  Fly    92 PTLW-----------------PVYNTVR---WFLYGYVSNDLLKGIG----KQALGRLRPHFFAV 132
              .|                 ||:...|   .|:..|::..|:..|.    |...|..||:|.::
 Worm   116 --FWLFSTKPRKIVYANCGECPVHLFTRRLFRFVIIYLAGLLIVQIFVDTIKLMTGYQRPYFLSL 178

  Fly   133 CS----------PHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMA 187
            |:          .|.|..|..|..::|||                  :.:|...::|||.|:.::
 Worm   179 CNVSITACTAPLEHSPSPSPHLACNYRGA------------------DELRYAWLTFPSLHAVVS 225

  Fly   188 FYGLVFVALHLRRRRWPLRGS-LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLG 247
            .|...|.:|:: .....|||: ||.|:|....:.|....:.||:..||:||.|:....::|
 Worm   226 SYAACFASLYI-YYMINLRGAPLLRPLLIFGFMGLCIVDSFSRINGYKNHWRDIWVAWVIG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 44/170 (26%)
plpr-1NP_496399.1 PAP2_wunen 142..293 CDD:239479 41/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.