DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and plpp-1.1

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_872025.1 Gene:plpp-1.1 / 173734 WormBaseID:WBGene00018756 Length:385 Species:Caenorhabditis elegans


Alignment Length:276 Identity:91/276 - (32%)
Similarity:144/276 - (52%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFNLSLRPPIRLLVDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPYHENTVSPTLLHW 65
            ||.|.::|.. |:|.|.::|.|:.:.:..|.. :.||.:|||:|||||:.||:.::.|:..:|..
 Worm     1 MSDNNTIRMS-RVLCDFLVLTLIAIPLYVFHE-FIPPVRRGFYCDDESIRYPFRDSKVTRQMLIV 63

  Fly    66 LGLYLPLISLVVLESFLS--------------HRKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKG 116
            :||.:|::.::..|.|.:              |.::.:....:..:|..:.:|..|...|.|:..
 Worm    64 VGLLIPILLILATELFRTLAWEKKCETEFKTYHVRNHSVHRLVVRLYCFIGYFFVGVCFNQLMVD 128

  Fly   117 IGKQALGRLRPHFFAVCSPHF-------PDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRD 174
            |.|..:||.||||..||.|..       ||             .|.||::|    :....:.|.:
 Worm   129 IAKYTIGRQRPHFMDVCRPDIGYQTCSQPD-------------LYITDFKC----TTTDTKKIHE 176

  Fly   175 VNVSFPSGHSAMAFYGLVFVALHLRRRRW-PLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWS 238
            ..:||.|||||.:||...|.:|:|:.|.: ||...||.||:|......|.:|:::||.|||||||
 Worm   177 AQLSFYSGHSAFSFYAAWFTSLYLQARLFRPLFSRLLLPVIQFLLFGGAAYVSLTRVSDYKHHWS 241

  Fly   239 DVAAGSLLGAGSALAV 254
            ||..|:::  |||:.|
 Worm   242 DVLVGAIM--GSAIGV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 61/167 (37%)
plpp-1.1NP_872025.1 PAP2_wunen 108..258 CDD:239479 61/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158348
Domainoid 1 1.000 122 1.000 Domainoid score I3483
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.