DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and SGPP2

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_689599.2 Gene:SGPP2 / 130367 HGNCID:19953 Length:399 Species:Homo sapiens


Alignment Length:217 Identity:47/217 - (21%)
Similarity:70/217 - (32%) Gaps:87/217 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 HWLGLYLPLISLVVLESFLSHRKDMAPWPTLWPVYNTVRWFL---YGYVSNDLLKGIGKQALGRL 125
            ||           .::.:||.|.             .:.|.|   .|.|:.|:||          
Human   110 HW-----------NIDPYLSRRL-------------IIIWVLVMYIGQVAKDVLK---------- 140

  Fly   126 RPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYG 190
                       :|..||                   |.:.:..:.:|.:..:  ||.| |||...
Human   141 -----------WPRPSS-------------------PPVVKLEKRLIAEYGM--PSTH-AMAATA 172

  Fly   191 LVFVAL--HLRRRRWPLRGSLLSPVLQLA-CVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSAL 252
            :.|..|  .:.|.::|.       ||.|. .|..:..|.:||:....|...||..|.|:.| ..:
Human   173 IAFTLLISTMDRYQYPF-------VLGLVMAVVFSTLVCLSRLYTGMHTVLDVLGGVLITA-LLI 229

  Fly   253 AVTRAAASEELQWRCQDSLASA 274
            .:|..|      |...|.|.||
Human   230 VLTYPA------WTFIDCLDSA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 35/164 (21%)
SGPP2NP_689599.2 PAP2_SPPase1 84..233 CDD:239482 40/197 (20%)
Phosphatase sequence motif I. /evidence=ECO:0000305 136..144 4/28 (14%)
Phosphatase sequence motif II. /evidence=ECO:0000305 163..166 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000305 206..217 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.