DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and sgpp2

DIOPT Version :10

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001373215.1 Gene:sgpp2 / 100330698 ZFINID:ZDB-GENE-120221-2 Length:415 Species:Danio rerio


Alignment Length:77 Identity:22/77 - (28%)
Similarity:29/77 - (37%) Gaps:9/77 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 DVNVSFPSGHSAMAFYGLVFVALHLRRRR--WPLRGSLLSPVLQLACVALAWFVAISRVIDYKHH 236
            |.....||.| |||...:.|..|.....|  :|....|...||      ::..|.:||:....|.
Zfish   169 DAEYGMPSTH-AMAATAISFTLLLSAEERVQFPFELGLAVAVL------MSVLVCLSRLYTGMHS 226

  Fly   237 WSDVAAGSLLGA 248
            ..||..|..:.|
Zfish   227 ALDVICGVAISA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 22/77 (29%)
sgpp2NP_001373215.1 PAP2_SPPase1 96..243 CDD:239482 22/77 (29%)

Return to query results.
Submit another query.