DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and plppr5b

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_021325770.1 Gene:plppr5b / 100093705 ZFINID:ZDB-GENE-070620-15 Length:351 Species:Danio rerio


Alignment Length:262 Identity:73/262 - (27%)
Similarity:120/262 - (45%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RGFFCDDESLMYPY--HENT--VSPTLLHWLGLYLPLISLVVLESFL-----------SHRKDMA 89
            :||||.:.:...||  .|:|  :.|.||:.:...:|.:.:.|.|:.|           |..|.|.
Zfish    39 QGFFCYETAYTKPYLGPEDTSAIPPALLYAVVTGVPTLMITVTETVLFLIQYTSKDLDSREKTMV 103

  Fly    90 PW------PTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESH 148
            ..      |.:...:..:..:|:|..:.|:....|:...|.|.|||..||.|:| ....|     
Zfish   104 TGDCCYLNPLVRRTFRFLGVYLFGLFTTDIFVNAGQVVTGNLAPHFLTVCKPNF-TALGC----- 162

  Fly   149 RGALKYHTDYE-CRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLSP 212
            :.||:|.:..| |..|     |:.|.....:|||..:|::.|..|::|:::..........|..|
Zfish   163 QQALRYISHQEACTGN-----EDDILRARKTFPSKEAALSVYAAVYMAMYITFTVKAKGTRLAKP 222

  Fly   213 VLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSA----LAVTRAAASEEL--QWRCQDSL 271
            |:.|..:.||:...|:||.:|::|||||.||.::|...|    :.|......::|  ....||:|
Zfish   223 VMSLGLMCLAFLTGINRVAEYRNHWSDVIAGFIIGVAIATFLVVCVVHNFKGKQLLDDDHSQDNL 287

  Fly   272 AS 273
            :|
Zfish   288 SS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 48/163 (29%)
plppr5bXP_021325770.1 PAP2_wunen 116..265 CDD:239479 48/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.