DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and plppr5a

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001121841.1 Gene:plppr5a / 100006660 ZFINID:ZDB-GENE-070705-281 Length:309 Species:Danio rerio


Alignment Length:237 Identity:65/237 - (27%)
Similarity:111/237 - (46%) Gaps:35/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RGFFCDDESLMYPY----HENTVSPTLLHWLGLYLPLISLVVLES------FLSHRKD------- 87
            :||||.|.:...||    ..:.:.|.:|:.:...:|.:.:.|.||      ::|...|       
Zfish    30 QGFFCHDNAYTKPYLGPEESSAIPPAILYAVVAGVPALVITVTESVLFLLQYVSEDLDNREKIIV 94

  Fly    88 MAPWPTLWP-VYNTVRW---FLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESH 148
            |.....|.| |..|.|:   :.:|..:.|:....|:...|.|.|:|..||.|:: ....|     
Zfish    95 MGDCCYLNPLVRRTFRFLGVYAFGLFATDIFVNAGQVVTGNLSPYFLTVCKPNY-TALGC----- 153

  Fly   149 RGALKYHTDYE-CRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLSP 212
            :..:::....: |..|     |:.|.....||||..:|::.|..::||:::..........|..|
Zfish   154 QQVVRFINQQDACTGN-----EDDILHARKSFPSKEAAISVYAALYVAMYITCSVKAKGTRLAKP 213

  Fly   213 VLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSALAV 254
            ||.|..:.||:...|:||::|::||:||.||.::  |.|:||
Zfish   214 VLSLGLMCLAFLTGINRVVEYRNHWADVIAGFII--GGAIAV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 48/164 (29%)
plppr5aNP_001121841.1 PAP2_wunen 107..256 CDD:239479 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577831
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.