DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and sgpp1b

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_001343219.1 Gene:sgpp1b / 100003745 ZFINID:ZDB-GENE-090319-2 Length:437 Species:Danio rerio


Alignment Length:78 Identity:23/78 - (29%)
Similarity:33/78 - (42%) Gaps:9/78 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 EMIRDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLSPVLQLACVALAW--FVAISRVID 232
            ||..:...|.||.| ||:...:......|...||..      |:|....:|::|  .|.:||:..
Zfish   191 EMFYNSEYSMPSTH-AMSGTAIPLSLFLLTYGRWEY------PMLLGLSLAISWCVLVCLSRIYM 248

  Fly   233 YKHHWSDVAAGSL 245
            ..|...|:.||.|
Zfish   249 GMHSILDIIAGFL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 23/78 (29%)
sgpp1bXP_001343219.1 PgpB 109..280 CDD:223743 23/78 (29%)
PAP2_SPPase1 122..270 CDD:239482 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.