DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and PLPPR4

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_055654.3 Gene:PLPPR4 / 9890 HGNCID:23496 Length:715 Species:Homo sapiens


Alignment Length:265 Identity:72/265 - (27%)
Similarity:122/265 - (46%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VELLVVVVLVIPICVYEF--AVDPVRRGFFCDDESISYPFQDNTITPVMLGLIVGLL---PALVM 99
            |||.::...|:.:...|.  ...||..||.|.|.|:|.|:.:.|...:...:::.|.   ||:.:
Human    25 VELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLSLAFAGPAITI 89

  Fly   100 VVVEYV-----SHLRAG-DISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTIGR 158
            :|.|.:     |..|.| .:...::..|...:::.....|......|||..|...|::.:.:.|.
Human    90 MVGEGILYCCLSKRRNGVGLEPNINAGGCNFNSFLRRAVRFVGVHVFGLCSTALITDIIQLSTGY 154

  Fly   159 LRPHFLAVCQPQIADGSM-CSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMI 222
            ..|:||.||:|.....:: |.:    :.|:....|:|...||  :...|.||||.|::||.:|.:
Human   155 QAPYFLTVCKPNYTSLNVSCKE----NSYIVEDICSGSDLTV--INSGRKSFPSQHATLAAFAAV 213

  Fly   223 YVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHY 287
            ||::|....:| ..|||.:..:.|..::......|:|:..:.:|..||..|.|:|...||....|
Human   214 YVSMYFNSTLT-DSSKLLKPLLVFTFIICGIICGLTRITQYKNHPVDVYCGFLIGGGIALYLGLY 277

  Fly   288 IARMF 292
            ....|
Human   278 AVGNF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 46/155 (30%)
PLPPR4NP_055654.3 PAP2_wunen 126..275 CDD:239479 46/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144643
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.