DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and CAX4

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_011550.3 Gene:CAX4 / 852924 SGDID:S000003268 Length:239 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:48/230 - (20%)
Similarity:83/230 - (36%) Gaps:64/230 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AVDPVRRGFFCDDESISYPFQDNTITPVMLGLIVGLLPALVMVVVEYVSHLRAGDISATVDLLGW 122
            |::|.......||..|.|...|..   ..|.....|:|.||:..  |:|                
Yeast     7 AINPNPNVIPFDDTYILYDSHDFL---SFLSAYFSLMPILVLAF--YLS---------------- 50

  Fly   123 RVSTWYV---ELGRQSTYFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQIADGSMCSDPVNLH 184
                |::   ||  ::....||.|:    .|:....|..:      :.||:         ||:. 
Yeast    51 ----WFIITREL--EACIVAFGQLM----NEIFNNVIKNI------IKQPR---------PVSF- 89

  Fly   185 RYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMIYVALYLQRKITWRG-SKLSRHFVQFAV 248
                     |..|..:.:|.. ...||.||....:...|.:|.:.  .:|:. :.|.:.....|:
Yeast    90 ---------GASFQNDTIRSG-YGMPSAHSQFMGFCFTYNSLKIY--TSWKNLNFLEKCIFSGAL 142

  Fly   249 VMVAWYTALSRVMDHWHHWSDVLSGSLLG-VAGAL 282
            .::::....|||..|:|:...|:.|..:| :.|:|
Yeast   143 ALLSFCVCFSRVYLHYHNLDQVIVGFSVGALTGSL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 33/155 (21%)
CAX4NP_011550.3 PAP2_dolichyldiphosphatase 17..179 CDD:239477 46/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.