DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and LPP4

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_566602.1 Gene:LPP4 / 821350 AraportID:AT3G18220 Length:308 Species:Arabidopsis thaliana


Alignment Length:271 Identity:69/271 - (25%)
Similarity:128/271 - (47%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RMTQRLLVELLVVVVLVIPICVYEFAVDPVRRGFFCDD--ESISYPFQDNTITPVMLGLIVGLLP 95
            ::.:..|.:.|::|||.: |.:....::|..| :...|  ..:::||.::||....:.:|..|:|
plant    17 KVAREHLCDWLILVVLGL-IDIVLNVIEPFHR-YIGPDMLTDLTFPFYEDTIPMWAVPIICILVP 79

  Fly    96 ALVMVVVEYVSHLRAGDISATVDL----LGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTI 156
            ..:.:|..|...    |:   .||    ||         :|       |..|:|...|:..|..:
plant    80 ICIFIVYYYYRR----DV---YDLHHAILG---------IG-------FSCLVTGVTTDSIKDAV 121

  Fly   157 GRLRPHFLAVCQPQIADGSMCSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAM 221
            ||.||:|...|.|        :.....|...::..|.|   ..:.:::...||||||:|.:|..:
plant   122 GRPRPNFFYRCFP--------NGKPKFHPDTKDVVCHG---VKKIIKEGYKSFPSGHTSWSFAGL 175

  Fly   222 IYVALYLQRKITW--RGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALIT 284
            .::|.||..||..  |...:::..:.|..::::....:|||.|:||||:||.:|:::|:..|..:
plant   176 TFLAWYLSGKIKVFDRRGHVAKLCLVFLPILISILIGISRVDDYWHHWTDVFAGAIIGIFVASFS 240

  Fly   285 -AHYIARMFDD 294
             .|:....:|:
plant   241 YLHFFPYPYDE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 44/157 (28%)
LPP4NP_566602.1 PgpB 23..246 CDD:223743 68/258 (26%)
PAP2_containing_1_like 55..244 CDD:239484 58/222 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.