DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and LPP3

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_566177.1 Gene:LPP3 / 821299 AraportID:AT3G02600 Length:364 Species:Arabidopsis thaliana


Alignment Length:352 Identity:92/352 - (26%)
Similarity:142/352 - (40%) Gaps:111/352 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GSTGPSSDRRMTQRLLVELLVVVVLVIPICV-------YEFAVDPVRRGFFCDDESISYPFQDNT 81
            |.|..|....:.:..:.:.:::|:|||..||       |.|    |.:....|   :|||.:.||
plant    58 GHTLRSHGMTVARTHMHDWIILVLLVILECVLLIIHPFYRF----VGKDMMTD---LSYPLKSNT 115

  Fly    82 ITPVMLGLIVGLLPALVMVVVEYVSHLRAGDI----SATVDLLGWRVSTWYVELGRQSTYFCFGL 142
            :....:.:...|||.::.:.:    :.|..|:    .|.:.||                   :.:
plant   116 VPIWSVPVYAMLLPLVIFIFI----YFRRRDVYDLHHAVLGLL-------------------YSV 157

  Fly   143 LLTFDATEVGKYTIGRLRPHFLAVCQPQIADGSMCSDPVNLHRYMENYDCAGEGFTVED---VRQ 204
            |:|...|:..|..:||.||.|...|.|   ||...            ||..|:.....|   :|:
plant   158 LVTAVLTDAIKNAVGRPRPDFFWRCFP---DGKAL------------YDSLGDVICHGDKSVIRE 207

  Fly   205 ARLSFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMV----AWYTALSRVMDHWH 265
            ...||||||:|.:|..:.:::|||..||.....|  .|..:..:|::    |....:|||.|:||
plant   208 GHKSFPSGHTSWSFSGLGFLSLYLSGKIQAFDGK--GHVAKLCIVILPLLFAALVGISRVDDYWH 270

  Fly   266 HWSDVLSGSLLGVAGALITAHYI-----------------------ARMFDDGASNILSGGLRRE 307
            ||.||.:|.|||:  |:.|..|:                       ||:  .||:|   |.::: 
plant   271 HWQDVFAGGLLGL--AISTICYLQFFPPPYHTEGWGPYAYFQVLEAARV--QGAAN---GAVQQ- 327

  Fly   308 NTAATLQEEVCPTTPPPYSVNNSFSED 334
                          ||| .|||...||
plant   328 --------------PPP-QVNNGEEED 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 50/161 (31%)
LPP3NP_566177.1 PLN02731 1..364 CDD:178332 92/352 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.