DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and PAP1

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001323948.1 Gene:PAP1 / 814646 AraportID:AT2G01180 Length:330 Species:Arabidopsis thaliana


Alignment Length:263 Identity:73/263 - (27%)
Similarity:116/263 - (44%) Gaps:60/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VVVVLVIPICVYEFAVDP----VRRGFFCDDESISYPFQDNTITPVMLGLIVGLLPALVMVVVEY 104
            :::|::|.|.:....:.|    |.:....|   :.|||:|||:....:.:...|||.:|.|.. |
plant    55 IILVILIAIEIGLNLISPFYRYVGKDMMTD---LKYPFKDNTVPIWSVPVYAVLLPIIVFVCF-Y 115

  Fly   105 VSHLRAGDISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQP 169
            :......|:..::             ||     ..|.:|:|...|:..|...||.||:|...|.|
plant   116 LKRTCVYDLHHSI-------------LG-----LLFAVLITGVITDSIKVATGRPRPNFYWRCFP 162

  Fly   170 QIADGSMCSDPVNLHRYMENYD------CAGEGFTVEDVRQARLSFPSGHSSLAFYAMIYVALYL 228
               ||.            |.||      |.|:   ..:|::...||||||:|.:|..:.:::|||
plant   163 ---DGK------------ELYDALGGVVCHGK---AAEVKEGHKSFPSGHTSWSFAGLTFLSLYL 209

  Fly   229 QRKITWRGSKLSRHFVQFAVV----MVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHYIA 289
            ..||  :......|..:..:|    :.|....:|||.|:||||.||.:|:|:|.    :.|.:..
plant   210 SGKI--KAFNNEGHVAKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGT----LVAAFCY 268

  Fly   290 RMF 292
            |.|
plant   269 RQF 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 51/164 (31%)
PAP1NP_001323948.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.