DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and PLPPR3

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_079164.1 Gene:PLPPR3 / 79948 HGNCID:23497 Length:746 Species:Homo sapiens


Alignment Length:356 Identity:81/356 - (22%)
Similarity:133/356 - (37%) Gaps:86/356 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VELLVVVVLVIPICVYEFA--VDPVRRGFFCDDESISYPF---QDNTITPVMLGLIVGLLPALVM 99
            |||.:|...::.:...|..  ..|.:.||.|.|.::|.|:   .:..|..:||..:....||..:
Human    24 VELPIVASSIVSLYFLELTDLFKPAKVGFQCYDRTLSMPYVETNEELIPLLMLLSLAFAAPAASI 88

  Fly   100 VVVEYVSHL-------RAG---DISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKY 154
            :|.|.:.:.       |||   ....:::..|...:::.....|......|||..|...|:|.:.
Human    89 MVAEGMLYCLQSRLWGRAGGPAGAEGSINAGGCNFNSFLRRTVRFVGVHVFGLCATALVTDVIQL 153

  Fly   155 TIGRLRPHFLAVCQPQIA-DGSMCSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAF 218
            ..|...|.||.||:|... .|:.|    .::.|:....|:|.  .:..:..||.:|||.|::|:.
Human   154 ATGYHTPFFLTVCKPNYTLLGTSC----EVNPYITQDICSGH--DIHAILSARKTFPSQHATLSA 212

  Fly   219 YAMIYV-----------ALYLQR----------------KITWRGSKLSRHFVQFAVVMVAWYTA 256
            :|.:||           ||.|.|                .:....:||.:..:.||..:.|....
Human   213 FAAVYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTTKLLKPILVFAFAIAAGVCG 277

  Fly   257 LSRVMDHWHHWSDVLSGSLLGVA-GALITAHYIARMFDDGASNILSGGLRRENTAATLQEEVCPT 320
            |:::..:..|..||.:|.|:|.. .|.:..|.:.                  |..|...|:  |.
Human   278 LTQITQYRSHPVDVYAGFLIGAGIAAYLACHAVG------------------NFQAPPAEK--PA 322

  Fly   321 TPPP----------------YSVNNSFSEDQ 335
            .|.|                |..|.|.|.|:
Human   323 APAPAKDALRALTQRGHDSVYQQNKSVSTDE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 46/183 (25%)
PLPPR3NP_079164.1 PAP2_wunen 129..306 CDD:239479 46/182 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144672
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.