DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and DOLPP1

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_065171.2 Gene:DOLPP1 / 57171 HGNCID:29565 Length:238 Species:Homo sapiens


Alignment Length:216 Identity:54/216 - (25%)
Similarity:86/216 - (39%) Gaps:50/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LPA----LVMVVVEYVSHLRAGDISATVDLLGW-RVSTWYVELGRQSTYFCFGLLLTFDATEVGK 153
            |||    :.:..|||    .|||:|.  .||.: .:|..:|.:|       |..|:.|...   .
Human     9 LPASWRPVTLTHVEY----PAGDLSG--HLLAYLSLSPVFVIVG-------FVTLIIFKRE---L 57

  Fly   154 YTIGRLRPHFLAVCQPQIADGSMCSDPVN---LHRYMENYDCAGEGFTVEDVRQARLSFPSGHSS 215
            :||.     ||.        |...::.||   .:...|...|.|....|    ..:...||.||.
Human    58 HTIS-----FLG--------GLALNEGVNWLIKNVIQEPRPCGGPHTAV----GTKYGMPSSHSQ 105

  Fly   216 LAFYAMIYVALYLQRKITWRGSK-----LSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVL---- 271
            ..::..:|..|:|..::....:.     |.||.:...::.||:..:.|||...:|.||.||    
Human   106 FMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGI 170

  Fly   272 SGSLLGVAGALITAHYIARMF 292
            :|.|:.:|..:.|...:..:|
Human   171 AGGLMAIAWFIFTQEVLTPLF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 38/166 (23%)
DOLPP1NP_065171.2 PAP2_dolichyldiphosphatase 16..180 CDD:239477 49/196 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.