DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and sgpp1a

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_684347.1 Gene:sgpp1a / 556439 ZFINID:ZDB-GENE-030131-4695 Length:436 Species:Danio rerio


Alignment Length:309 Identity:70/309 - (22%)
Similarity:105/309 - (33%) Gaps:111/309 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SASGSAAG-------STGPSSDRRMTQRLLVELLVVVVLVIPICVYEFAVD--------PVRRG- 65
            |.:|:.||       ::|.|:||...|||...|.|..    ..|.:....|        |:||. 
Zfish    47 SVNGACAGQRQGAREASGDSADRLPGQRLRKSLNVKQ----DECAHNGPADTDPKGTVKPLRRNS 107

  Fly    66 --------FFCDDESISYPFQDNTITPVMLGLIVGLLPALVMVVVEYVSHLRAGDISATVDLLGW 122
                    |..:::.:.|.|...|.....:..|| ..|.|:..|..|||...         ::.|
Zfish   108 LTGDVGQEFIIENKFLFYLFTIGTELGNEMFFIV-FFPFLMWNVDPYVSRQL---------IVVW 162

  Fly   123 RVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQIADGSMCSDPVNLHRYM 187
               .|.:.|| |||            .:|.::|    ||               .|.||      
Zfish   163 ---AWVLFLG-QST------------KDVVRWT----RP---------------ASPPV------ 186

  Fly   188 ENYDCAGEGFTVEDVRQARLSFPSGH----SSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAV 248
                     ..||....:..|.||.|    ::|.|      :|:|.....|      .:...|.:
Zfish   187 ---------VKVEVFYNSEYSMPSTHAMSGTALPF------SLFLLTCSRW------EYPFMFGL 230

  Fly   249 VMVAWYTAL---SRVMDHWHHWSDVLSGSLLGVAGALITAHYIARMFDD 294
            .:..:::.|   ||:....|...:|::|.|..|   ||.| .:..|.||
Zfish   231 SIALFWSILVCISRIYMGMHSVLEVITGFLYSV---LILA-VLHPMLDD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 34/161 (21%)
sgpp1aXP_684347.1 PAP2_SPPase1 121..270 CDD:239482 48/224 (21%)
PgpB <122..281 CDD:223743 51/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.