DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and PLPPR1

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_060223.2 Gene:PLPPR1 / 54886 HGNCID:25993 Length:325 Species:Homo sapiens


Alignment Length:301 Identity:74/301 - (24%)
Similarity:134/301 - (44%) Gaps:71/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TQR--------LLVELLVVVVLVIPICVYEFAVDPVR---RGFFCDDESISYPF----QDNTITP 84
            |||        :.|||:::...|: :..|....|..:   :||||.|..:..|:    :::.|||
Human     7 TQRSYSIIPCFIFVELVIMAGTVL-LAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP 70

  Fly    85 VMLGLIVGLLPALVMVVVEYVSHLRAGDISATVDLLGWRVSTWYVELGRQST------------- 136
            ::|..::...|..::.:.|                    :|.::::..|:|.             
Human    71 LVLYCVLAATPTAIIFIGE--------------------ISMYFIKSTRESLIAQEKTILTGECC 115

  Fly   137 --------------YFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQIADGSMCSDPVNLHRYM 187
                          .|.|||..|......|:...|.|.|:||.||:|....    :|....|:::
Human   116 YLNPLLRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTS----ADCQAHHQFI 176

  Fly   188 ENYD-CAGEGFTVEDVRQARLSFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMV 251
            .|.: |.|:   :|.:.:||.||||.|::|:.|:.:|..:|:...|..:.|:|::..:....:..
Human   177 NNGNICTGD---LEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCT 238

  Fly   252 AWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHYIARMF 292
            |:.|.|:||.::.:|.|||::|.:||.|.||.....:...|
Human   239 AFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 51/182 (28%)
PLPPR1NP_060223.2 PAP2_wunen 123..272 CDD:239479 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.