DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and plpp1

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_012816123.1 Gene:plpp1 / 496488 XenbaseID:XB-GENE-958883 Length:284 Species:Xenopus tropicalis


Alignment Length:280 Identity:103/280 - (36%)
Similarity:164/280 - (58%) Gaps:20/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLVELLVVVVLVIPICVYEFAV-DPVRRGFFCDDESISYPFQDNTITPVMLGLIVGLLPALVMVV 101
            ::::::.||:..:|:.|.:... .|.:|||||||:||.|||.|:|:|..:|..:...:|...|::
 Frog    10 VILDIVCVVLAALPLGVLKLITKKPYQRGFFCDDDSIKYPFHDSTVTSTVLYAVGFTVPICSMIL 74

  Fly   102 VEYVSHLRAGDISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTIGRLRPHFLAV 166
            .|.:| :...|:.::..:....|:|.|..:|.    |.||..::...|::.||||||||||||.|
 Frog    75 GETLS-VFYNDLRSSAFIRNNYVATIYKAIGT----FIFGAAVSQSLTDIAKYTIGRLRPHFLDV 134

  Fly   167 CQPQIADGSMCSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMIYVALYLQRK 231
            |:|..:..: ||     ..|:|.:.|.|:   .....:|||||.|||||.:.|.|:::|||||.:
 Frog   135 CKPNWSKIN-CS-----LGYIETFVCEGD---PTKSSEARLSFYSGHSSFSMYCMVFLALYLQSR 190

  Fly   232 ITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLG-VAGALITAHYIARMFDDG 295
            :....::|.|..:|||::.|:.|..||||.|:.|||||||:|.:.| |.|.||.. |::..|.:.
 Frog   191 LRADWARLLRPTIQFALIAVSVYVGLSRVSDYKHHWSDVLTGLIQGAVVGVLIVV-YVSDFFKEK 254

  Fly   296 ASNILSGGLRRENTAATLQE 315
            ..::   ..:.|::..||.|
 Frog   255 KGSL---NQKEEDSHTTLHE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 68/155 (44%)
plpp1XP_012816123.1 PAP2_wunen 99..237 CDD:239479 64/150 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.