DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and Sgpp2

DIOPT Version :10

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001004173.1 Gene:Sgpp2 / 433323 MGIID:3589109 Length:354 Species:Mus musculus


Alignment Length:50 Identity:14/50 - (28%)
Similarity:26/50 - (52%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SISYPFQDNTITPVMLGLIVGLLPALVMVVVEYVSHLRAGDISATVDLLG 121
            :||:....:|:.......|:||:.|:|...:..:|.|..| :...:|:||
Mouse   127 AISFTLLISTMDRYQYPFILGLMMAVVFSTLVCLSRLYTG-MHTVLDILG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479
Sgpp2NP_001004173.1 PAP2_SPPase1 39..188 CDD:239482 13/49 (27%)
Phosphatase sequence motif I. /evidence=ECO:0000305 91..99
Phosphatase sequence motif II. /evidence=ECO:0000305 118..121
Phosphatase sequence motif III. /evidence=ECO:0000305 161..172 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.