DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and Sgpp2

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001004173.1 Gene:Sgpp2 / 433323 MGIID:3589109 Length:354 Species:Mus musculus


Alignment Length:50 Identity:14/50 - (28%)
Similarity:26/50 - (52%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SISYPFQDNTITPVMLGLIVGLLPALVMVVVEYVSHLRAGDISATVDLLG 121
            :||:....:|:.......|:||:.|:|...:..:|.|..| :...:|:||
Mouse   127 AISFTLLISTMDRYQYPFILGLMMAVVFSTLVCLSRLYTG-MHTVLDILG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479
Sgpp2NP_001004173.1 PAP2_SPPase1 39..188 CDD:239482 13/49 (27%)
Phosphatase sequence motif I. /evidence=ECO:0000305 91..99
Phosphatase sequence motif II. /evidence=ECO:0000305 118..121
Phosphatase sequence motif III. /evidence=ECO:0000305 161..172 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.