DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and plppr1

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001002132.1 Gene:plppr1 / 415222 ZFINID:ZDB-GENE-040625-138 Length:333 Species:Danio rerio


Alignment Length:285 Identity:77/285 - (27%)
Similarity:129/285 - (45%) Gaps:53/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLVELLVVVVLVIPI----CVYEFAVDPVRRGFFCDDESISYPF----QDNTITPVMLGLIVGLL 94
            :.|||:::...|:..    |...|.:.  .:||||:|..:..|:    :.:.|.|::|..:|...
Zfish    17 IFVELVIMAGTVLLAYYFECTDTFGIH--IQGFFCNDADLLKPYPGPEESSFIQPLILYCVVAAA 79

  Fly    95 PALVMVVVEYVSHLRAGDISATVDLLGWRVSTWYVELGRQST---------------------YF 138
            |..::.|         |:||..:     ..||....|.::.|                     .|
Zfish    80 PTAIIFV---------GEISMYI-----MKSTGEALLAQEKTIVTGECCYLNPLIRRIIRFIGVF 130

  Fly   139 CFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQIADGSMCSDPVNLHRYMENYD-CAGEGFTVEDV 202
            .|||..|......|:...|.|.|:||.||:|... |..|...   |:::.|.: |.|....||  
Zfish   131 AFGLFATDIFVNAGQVVTGNLAPYFLNVCKPNYT-GLDCHFS---HQFIANGNICTGNQVVVE-- 189

  Fly   203 RQARLSFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHW 267
             :||.||||..:||:.|:.:||.:|:...|..:.|:|::..:...::..|:.|.|:||.::.:|.
Zfish   190 -RARRSFPSKDASLSVYSAVYVTMYITSTIKTKSSRLAKPVLCLGLLCAAFLTGLNRVSEYRNHC 253

  Fly   268 SDVLSGSLLGVAGALITAHYIARMF 292
            |||::|.:||.:.||.....:...|
Zfish   254 SDVVAGFILGSSIALFLGICVVNNF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 53/176 (30%)
plppr1NP_001002132.1 PAP2_wunen 122..271 CDD:239479 51/155 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.