DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and CG12746

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster


Alignment Length:212 Identity:63/212 - (29%)
Similarity:92/212 - (43%) Gaps:42/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RAGDISATVDLLGWRVST---------WYVELGRQ----STYFCFGLLLTFDATEVGKYTIGRLR 160
            |..||....:||.|.:..         ||....|.    |..:...|.:....|.|.|.|:||.|
  Fly   110 RRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPR 174

  Fly   161 PHFLAVCQPQIADGSMCSDPVN--LHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMIY 223
            |.:...|.|   ||.|..:..:  :...:.:::|.|   ...|:.:.|.||||||||.||.:..:
  Fly   175 PDYFYRCFP---DGVMVLNTTSNGVDTSILDFNCTG---LPGDINEGRKSFPSGHSSFAFASFGF 233

  Fly   224 VALYLQRKI----------TWRGSKLSRHFVQFAVV--MVAWYTALSRVMDHWHHWSDVLSGSLL 276
            :|.|:..|:          |||        :..||:  .:|...|:||..|:.|||.||..|.|:
  Fly   234 IAYYIGAKLHAFDSRGRGHTWR--------LCIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLI 290

  Fly   277 GV-AGALITAHYIARMF 292
            |: ||.:....|...:|
  Fly   291 GLFAGYISYTQYYPSIF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 53/173 (31%)
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 61/205 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.