DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and CG11437

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649393.1 Gene:CG11437 / 40470 FlyBaseID:FBgn0037165 Length:305 Species:Drosophila melanogaster


Alignment Length:276 Identity:82/276 - (29%)
Similarity:137/276 - (49%) Gaps:24/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RMTQRLLVELLVVV------VLVIPICVYEFAVDPVRRGFFCDDESISYPFQDNTITPVMLGLIV 91
            |:..||:::.|:::      ::|:|     ..:...:|||.|.|.|:.||::...:|.|.|.:.|
  Fly     8 RLLSRLVIDFLILLGIYGAALVVLP-----QQLSTAQRGFHCSDTSLKYPYRQPWLTKVHLTIAV 67

  Fly    92 GLLPALVMVVVEYVSHLRAGDISATVDL------LGWRVSTWYVELGRQSTYFCFGLLLTFDATE 150
            ..|||..::|||.   |||..:.::.:|      :|.|:..:..|..:....:.|||.||..|..
  Fly    68 VALPAAFVLVVEM---LRAAVVPSSTELTQRFVFVGVRIPRFISECYKAIGVYLFGLGLTLAAIR 129

  Fly   151 VGKYTIGRLRPHFLAVCQPQ--IADGSMCSDPV--NLHRYMENYDCAGEGFTVEDVRQARLSFPS 211
            :.|::.|||||:|..:|||.  ...|..|||..  |...|:|::.|.....:.:.:...|.||||
  Fly   130 LTKHSTGRLRPYFFDICQPTWGTEGGESCSDVTAQNSTLYLEDFSCTEFAASQDLLALVRHSFPS 194

  Fly   212 GHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLL 276
            |..|...|||.::..|.|.::.....:|.|..:|.|...:|......|:..:.:|.:||.:|:.|
  Fly   195 GFVSTTCYAMGFLIFYSQARLFAPWLRLVRASLQLACCSLALVVCWERISTYQNHLTDVAAGAAL 259

  Fly   277 GVAGALITAHYIARMF 292
            |...|.....::|.:|
  Fly   260 GGWMAFFATVFVAHLF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 50/158 (32%)
CG11437NP_649393.1 PAP2_wunen 109..268 CDD:239479 50/158 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - otm46697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.