DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and plpp2

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_989117.1 Gene:plpp2 / 394722 XenbaseID:XB-GENE-5816438 Length:283 Species:Xenopus tropicalis


Alignment Length:280 Identity:91/280 - (32%)
Similarity:144/280 - (51%) Gaps:53/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRRMTQRLLVELLVVVVLVIPICVYEFAVDPVRRGFFCDDESISYPFQDNTITPVMLGLIVGLLP 95
            |||... :::::|.|.|..:|..:......|.:|||:|:||||.||::::|||.   ||:.|:..
 Frog     4 DRRNVY-VVLDVLCVSVASLPFIIMSLVNSPYKRGFYCNDESIRYPYREDTITN---GLMAGVTI 64

  Fly    96 ALVMVVVEYVSHLRAGD------------------ISATVDLLGWRVSTWYVELGRQSTYFCFGL 142
            :..::::.      :|:                  |:|...::|              ||. ||.
 Frog    65 SCTVIIIS------SGEMYMVFSKRLYSRSECNNYIAALYKVVG--------------TYL-FGA 108

  Fly   143 LLTFDATEVGKYTIGRLRPHFLAVCQPQIADGSMCSDPVNLHRYMENYDCAGEGFTVEDVRQARL 207
            .::...|::.||.|||.||:|:|||.|   |.|    .||...|:.::.|.|....|.|   :||
 Frog   109 AISQSLTDLAKYMIGRPRPNFIAVCDP---DWS----TVNCSGYVTDFTCRGNYANVTD---SRL 163

  Fly   208 SFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLS 272
            ||.|||||...|.|::::||:|.::..:.::|.|..:||.::..|.|...:||.|:.|||||||.
 Frog   164 SFYSGHSSFGMYCMLFLSLYVQARLCGKWARLLRPTIQFFLLSFALYVGYTRVSDYKHHWSDVLV 228

  Fly   273 GSLLGVAGALITAHYIARMF 292
            |.|.|...|..|..|::..|
 Frog   229 GLLQGAIVAAFTVRYVSDFF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 60/154 (39%)
plpp2NP_989117.1 PAP2_wunen 96..241 CDD:239479 62/169 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4216
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3614
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - mtm9459
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X571
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.170

Return to query results.
Submit another query.