DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and plppr2a

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_956750.1 Gene:plppr2a / 393428 ZFINID:ZDB-GENE-040426-1171 Length:360 Species:Danio rerio


Alignment Length:338 Identity:85/338 - (25%)
Similarity:140/338 - (41%) Gaps:62/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MPASASGSAAGSTGPSSDRRMTQR--------LLVELLVVVVLVIPICVYEFA-VDPVR-RGFFC 68
            |...:.....|||..:.::...:.        |.|||:::...|:....:|:. ..||. :||||
Zfish     1 MRGGSEQKGGGSTMAAEEKPAVKSSSSIIPCFLFVELVIMAGTVLMAYYFEYTDTFPVHIQGFFC 65

  Fly    69 DDESIS--YPFQDNT--ITPVMLGLIVGLLPALVMVVVE-YVSHLRAGDIS----ATVDLLGWRV 124
            .|::.|  ||..|.|  :.||::..::..:|.:.::..| .|..:||....    .|.|      
Zfish    66 FDKAFSKPYPGPDETSNVPPVLVYSLIAAIPTITILAGEVMVFFMRAEGTQEKTIVTAD------ 124

  Fly   125 STWYVELGRQSTYF----CFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQ-IADGSMCSDPVNLH 184
            ..::..|.|:...|    .||:..|......|:...|...||||:.|:|. .|.|  |..  ||.
Zfish   125 CCYFNPLLRRIIRFLGVYTFGVFTTTIFANAGQVVTGNQTPHFLSACRPNYTALG--CHS--NLQ 185

  Fly   185 RYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVV 249
            ...|...|.|....   |..||.||||..::|:.|:.:|..:|:......:|::|::..:...::
Zfish   186 YITERKACTGNPLI---VASARKSFPSKDAALSVYSAVYTVMYVTLVFRTKGTRLTKPTLSLTLL 247

  Fly   250 MVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHYIARMFDDGASNILSGGLRRENTAATLQ 314
            .:|....:.||.::.:||||||:|...|.|.|:.....:...|..                    
Zfish   248 CLAMLVGVVRVAEYRNHWSDVLAGFFTGGAIAVFLVTCVINNFQQ-------------------- 292

  Fly   315 EEVCPTTPPPYSV 327
                 |.|||.:|
Zfish   293 -----TKPPPPAV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 48/159 (30%)
plppr2aNP_956750.1 PAP2_wunen 134..283 CDD:239479 46/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.