DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and Plppr3

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_853665.2 Gene:Plppr3 / 314614 RGDID:727823 Length:716 Species:Rattus norvegicus


Alignment Length:327 Identity:82/327 - (25%)
Similarity:133/327 - (40%) Gaps:58/327 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VELLVVVVLVIPICVYEFA--VDPVRRGFFCDDESISYPF---QDNTITPVMLGLIVGLLPALVM 99
            |||.:|...|:.:...|..  ..|.:.||.|.|.|:|.|:   .:..|..:||..:....||..:
  Rat    24 VELPIVASSVVSLYFLELTDLFQPAKVGFQCHDRSLSMPYVETNEELIPLLMLLSLAFAAPAASI 88

  Fly   100 VVVE---YVSHLR-----AGDISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTI 156
            :|.|   |....|     .|.:..:::..|...:::.....|......|||..|...|:|.:...
  Rat    89 MVGEGMVYCLQSRLWGRGPGGVEGSINAGGCNFNSFLRRTVRFVGVHVFGLCATALVTDVIQLAT 153

  Fly   157 GRLRPHFLAVCQPQIA-DGSMC-SDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFY 219
            |...|.||.||:|... .|:.| ::|     |:....|:|.  ....:..||.:|||.|::|:.:
  Rat   154 GYHTPFFLTVCKPNYTLLGTSCEANP-----YITQDICSGH--DTHAILSARKTFPSQHATLSAF 211

  Fly   220 AMIYVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVA-GALI 283
            |.:||::|....|: ..:||.:..:.||..:.|....|:::..:..|..||.:|.|:|.. .|.:
  Rat   212 AAVYVSMYFNSVIS-DATKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAAYL 275

  Fly   284 TAHYIARMFDDGASNILSGGLRRENTAATLQEEVCPTTPPP---------------YSVNNSFSE 333
            ..|.:.                  |..|:..|:| |...|.               |..|.|.|.
  Rat   276 ACHAVG------------------NFQASPAEKV-PAPAPAKDALRVLTQRGHESMYQQNKSVST 321

  Fly   334 DQ 335
            |:
  Rat   322 DE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 45/157 (29%)
Plppr3NP_853665.2 PAP2_wunen 127..276 CDD:239479 45/156 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..334 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..488
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338366
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.