DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and Plpp4

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_038934456.1 Gene:Plpp4 / 309014 RGDID:1306289 Length:273 Species:Rattus norvegicus


Alignment Length:245 Identity:68/245 - (27%)
Similarity:97/245 - (39%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRLLVELLVVVVLVIPICVYEFAVDPVRRGFFCDDESI---SYPF--QDNTITPVMLGLIVGLLP 95
            :.|.:| :.|..|:..:.|:...:||.:|  ....|.|   ..|.  .||..|.:|.. |..|.|
  Rat     2 RELAIE-IGVRALLFGVFVFTEFLDPFQR--VIQPEEIWLYKNPLVQSDNIPTRLMFA-ISFLTP 62

  Fly    96 ALVMVVVEYVSHLRAGDISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTIGRLR 160
            ..|:.||:.:......:|                   :::......|.|....|...|..:||.|
  Rat    63 LAVICVVKIIRRTDKTEI-------------------KEAFLVSLALALNGVCTNTIKLIVGRPR 108

  Fly   161 PHFLAVCQPQIADGSMCSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMIYVA 225
            |.|...|.|   ||.|.|:   :|       |.|:   .:.|.:.|.||||.|||.||..:.:..
  Rat   109 PDFFYRCFP---DGVMNSE---MH-------CTGD---PDLVSEGRKSFPSIHSSFAFSGLGFTT 157

  Fly   226 LYLQRKI-----TWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDV 270
            .||..|:     :.|| |..|.......:..|...||||:.|:.|||..|
  Rat   158 FYLAGKLHCFTESGRG-KSWRLCAAILPLYCAMMIALSRMCDYKHHWQAV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 46/146 (32%)
Plpp4XP_038934456.1 PAP2_containing_1_like 37..206 CDD:239484 57/205 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.