DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and Plppr2

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006242690.1 Gene:Plppr2 / 300443 RGDID:1597171 Length:452 Species:Rattus norvegicus


Alignment Length:333 Identity:82/333 - (24%)
Similarity:136/333 - (40%) Gaps:58/333 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLVELLVVVVLVIPICVYEFA-VDPVR-RGFFCDDESISYPFQD----NTITPVMLGLIVGLLPA 96
            :.||.:::.::::.....||. ..||. :||||.|.:.:.|:..    :...|.::..:|...|.
  Rat    19 VFVESVLLGIVILLAYRLEFTDTFPVHTQGFFCYDSAYAKPYPGPEAASRAPPALIYALVTAGPT 83

  Fly    97 LVMVVVE-----YVSHLRAGDISATVDLLG---WRVSTWYVELGRQSTYFCFGLLLTFDATEVGK 153
            |.:::.|     :.:...|..:|....::.   .|.|.....|.|....:.|||..|......|:
  Rat    84 LTILLGELARAFFPAPPSASPVSGESTIVSGACCRFSPPLRRLVRFLGVYSFGLFTTTIFANAGQ 148

  Fly   154 YTIGRLRPHFLAVCQPQ-------------------IADGSMCSDPVNLHRYMENYDCAGEGFTV 199
            ...|...||||:||:|.                   :.|.|.|:...:|                
  Rat   149 VVTGNPTPHFLSVCRPNYTALGCPPPSPDRPGPDRFVTDQSACAGSPSL---------------- 197

  Fly   200 EDVRQARLSFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHW 264
              |..||.:||...::|..||:.|.|:|:......:||:|.:..:..|::..|:...:.||.::.
  Rat   198 --VAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSLCLALLCPAFLVGVVRVAEYR 260

  Fly   265 HHWSDVLSGSLLGVAGALITAHYIARMFDDGASNILSGGLRRENTAATLQEEVCPTTPPPYSVNN 329
            :||||||:|.|.|.|.|......:...|.   |..|||  ||.:....|.:  .||...|....:
  Rat   261 NHWSDVLAGFLTGAAIATFLVTCVVHNFQ---SRPLSG--RRLSPWEDLSQ--APTMDSPLEKLS 318

  Fly   330 SFSEDQYC 337
            ...|.:.|
  Rat   319 VAQEPETC 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 48/173 (28%)
Plppr2XP_006242690.1 PAP2_wunen 125..281 CDD:239479 48/173 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338313
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.