DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and Plppr4

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001001508.2 Gene:Plppr4 / 295401 RGDID:727806 Length:766 Species:Rattus norvegicus


Alignment Length:265 Identity:72/265 - (27%)
Similarity:122/265 - (46%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VELLVVVVLVIPICVYEF--AVDPVRRGFFCDDESISYPFQDNTITPVMLGLIVGLL---PALVM 99
            |||.::...|:.:...|.  ...||..||.|.|.|:|.|:.:.|...:...:::.|.   ||:.:
  Rat    74 VELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLSLAFAGPAITI 138

  Fly   100 VVVEYV-----SHLRAG-DISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTIGR 158
            :|.|.:     |..|.| .:...::..|...:::.....|......|||..|...|::.:.:.|.
  Rat   139 MVGEGILYCCLSKRRNGAGLEPNINAGGCNFNSFLRRAVRFVGVHVFGLCSTALITDIIQLSTGY 203

  Fly   159 LRPHFLAVCQPQIADGSM-CSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMI 222
            ..|:||.||:|.....:: |.:    :.|:....|:|...||  :...|.||||.|::||.:|.:
  Rat   204 QAPYFLTVCKPNYTSLNVSCKE----NSYIVEDICSGSDLTV--INSGRKSFPSQHATLAAFAAV 262

  Fly   223 YVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHY 287
            ||::|....:| ..|||.:..:.|..::......|:|:..:.:|..||..|.|:|...||....|
  Rat   263 YVSMYFNSTLT-DSSKLLKPLLVFTFIICGIICGLTRITQYKNHPVDVYCGFLIGGGIALYLGLY 326

  Fly   288 IARMF 292
            ....|
  Rat   327 AVGNF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 46/155 (30%)
Plppr4NP_001001508.2 PAP2_wunen 175..324 CDD:239479 46/155 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..529
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 672..705
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 741..766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338337
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.