DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and Plppr2

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001277228.1 Gene:Plppr2 / 235044 MGIID:2384575 Length:452 Species:Mus musculus


Alignment Length:334 Identity:84/334 - (25%)
Similarity:134/334 - (40%) Gaps:60/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLVELLVVVVLVIPICVYEFA-VDPVR-RGFFCDDESISYPFQD----NTITPVMLGLIVGLLPA 96
            :.||.:::.::|:.....||. ..||. :||||.|.:.:.|:..    :...|.::..:|...|.
Mouse    19 VFVESVLLGIVVLLAYRLEFTDTFPVHTQGFFCYDSAYAKPYPGPEAASRAPPALIYALVTAGPT 83

  Fly    97 LVMVVVEYV---------SHLRAGDISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVG 152
            |.:::.|..         |...:|: |..|.....|.|.....|.|....:.|||..|......|
Mouse    84 LTILLGELARAFFPAPPSSSPVSGE-STIVSGACCRFSPPLRRLVRFLGVYSFGLFTTTIFANAG 147

  Fly   153 KYTIGRLRPHFLAVCQPQ-------------------IADGSMCSDPVNLHRYMENYDCAGEGFT 198
            :...|...||||:||:|.                   :.|.|.|:...:|               
Mouse   148 QVVTGNPTPHFLSVCRPNYTALGCPPPSPDRPGPDRFVTDQSACAGSPSL--------------- 197

  Fly   199 VEDVRQARLSFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDH 263
               |..||.:||...::|..||:.|.|:|:......:||:|.:..:..|::..|:...:.||.::
Mouse   198 ---VAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSLCLALLCPAFLVGVVRVAEY 259

  Fly   264 WHHWSDVLSGSLLGVAGALITAHYIARMFDDGASNILSGGLRRENTAATLQEEVCPTTPPPYSVN 328
            .:||||||:|.|.|.|.|......:...|.   |...||  ||.:....|.:  .||...|....
Mouse   260 RNHWSDVLAGFLTGAAIATFLVTCVVHNFQ---SRPHSG--RRLSPWEDLSQ--APTMDSPLEKL 317

  Fly   329 NSFSEDQYC 337
            :...|.:.|
Mouse   318 SVAQEPETC 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 48/173 (28%)
Plppr2NP_001277228.1 PAP2_wunen 125..281 CDD:239479 48/173 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.