DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and PLPP4

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001025230.1 Gene:PLPP4 / 196051 HGNCID:23531 Length:271 Species:Homo sapiens


Alignment Length:266 Identity:74/266 - (27%)
Similarity:106/266 - (39%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRLLVELLVVVVLVIPICVYEFAVDPVRRGFFCDDESI---SYPF--QDNTITPVMLGLIVGLLP 95
            :.|.:| :.|..|:..:.|:...:||.:|  ....|.|   ..|.  .||..|.:|.. |..|.|
Human     2 RELAIE-IGVRALLFGVFVFTEFLDPFQR--VIQPEEIWLYKNPLVQSDNIPTRLMFA-ISFLTP 62

  Fly    96 ALVMVVVEYVSHLRAGDISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFD--ATEVGKYTIGR 158
            ..|:.||:.:......:|                    :..:....|.|..:  .|...|..:||
Human    63 LAVICVVKIIRRTDKTEI--------------------KEAFLAVSLALALNGVCTNTIKLIVGR 107

  Fly   159 LRPHFLAVCQPQIADGSMCSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMIY 223
            .||.|...|.|   ||.|.|:   :|       |.|:   .:.|.:.|.||||.|||.||..:.:
Human   108 PRPDFFYRCFP---DGVMNSE---MH-------CTGD---PDLVSEGRKSFPSIHSSFAFSGLGF 156

  Fly   224 VALYLQRKI-----TWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALI 283
            ...||..|:     :.|| |..|.......:..|...||||:.|:.|||.|...|.::|:..|.|
Human   157 TTFYLAGKLHCFTESGRG-KSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYI 220

  Fly   284 --TAHY 287
              ..||
Human   221 CYRQHY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 50/163 (31%)
PLPP4NP_001025230.1 PAP2_containing_1_like 37..225 CDD:239484 62/225 (28%)
Phosphatase sequence motif I. /evidence=ECO:0000269|PubMed:17590538 102..110 3/7 (43%)
Phosphatase sequence motif II. /evidence=ECO:0000269|PubMed:17590538 143..146 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000269|PubMed:17590538 195..205 5/9 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144665
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.730

Return to query results.
Submit another query.