DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and plpr-1

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_496399.1 Gene:plpr-1 / 174710 WormBaseID:WBGene00011524 Length:396 Species:Caenorhabditis elegans


Alignment Length:287 Identity:64/287 - (22%)
Similarity:109/287 - (37%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RGFFCDDES--------------ISYPFQDNTITPVMLGLIVGLLPALVMVVVEYVSHLRAGDIS 114
            |.|:|.|..              :|||         :|..:...:|.||:::.|           
 Worm    69 RVFYCRDVHLYKPNFVPEDFNVYVSYP---------LLYTLAFTIPPLVILIGE----------- 113

  Fly   115 ATVDLLGWRVST-----WYVELG------------RQSTYFCFGLLLTFDATEVGKYTIGRLRPH 162
                ::.|..||     .|...|            |....:..|||:.....:..|...|..||:
 Worm   114 ----VMFWLFSTKPRKIVYANCGECPVHLFTRRLFRFVIIYLAGLLIVQIFVDTIKLMTGYQRPY 174

  Fly   163 FLAVCQPQIADGSMCSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMIYVALY 227
            ||::|...|   :.|:.|:. |....:...|......:::|.|.|:|||.|:.::.||..:.:||
 Worm   175 FLSLCNVSI---TACTAPLE-HSPSPSPHLACNYRGADELRYAWLTFPSLHAVVSSYAACFASLY 235

  Fly   228 LQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHYIARMF 292
            :...|..||:.|.|..:.|..:.:....:.||:..:.:||.|:....::|:..|.... |....|
 Worm   236 IYYMINLRGAPLLRPLLIFGFMGLCIVDSFSRINGYKNHWRDIWVAWVIGIFMAWFLC-YCVLCF 299

  Fly   293 DDGASNILSGGLRRENTAATLQEEVCP 319
            .:.....:      |.|....:|.|.|
 Worm   300 QEVYHMTI------ERTPIVQEERVSP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 41/166 (25%)
plpr-1NP_496399.1 PAP2_wunen 142..293 CDD:239479 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.