DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and plppr5a

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001121841.1 Gene:plppr5a / 100006660 ZFINID:ZDB-GENE-070705-281 Length:309 Species:Danio rerio


Alignment Length:281 Identity:77/281 - (27%)
Similarity:133/281 - (47%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LVVVVLVIPICVYEFAVDPVR---RGFFCDDESISYPF----QDNTITPVMLGLIVGLLPALVMV 100
            ||::...:.:..|....|...   :||||.|.:.:.|:    :.:.|.|.:|..:|..:||||:.
Zfish     6 LVIMAGTVMLAYYFEYTDTFNVHVQGFFCHDNAYTKPYLGPEESSAIPPAILYAVVAGVPALVIT 70

  Fly   101 VVE-------YVSH--------LRAGD-------ISATVDLLGWRVSTWYVELGRQSTYFCFGLL 143
            |.|       |||.        :..||       :..|...||               .:.|||.
Zfish    71 VTESVLFLLQYVSEDLDNREKIIVMGDCCYLNPLVRRTFRFLG---------------VYAFGLF 120

  Fly   144 LTFDATEVGKYTIGRLRPHFLAVCQPQ-IADGSMCSDPVNLHRYMENYD-CAGEGFTVEDVRQAR 206
            .|......|:...|.|.|:||.||:|. .|.|  |...|   |::...| |.|   ..:|:..||
Zfish   121 ATDIFVNAGQVVTGNLSPYFLTVCKPNYTALG--CQQVV---RFINQQDACTG---NEDDILHAR 177

  Fly   207 LSFPSGHSSLAFYAMIYVALYLQRKITWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVL 271
            .||||..::::.||.:|||:|:...:..:|::|::..:...::.:|:.|.::||:::.:||:||:
Zfish   178 KSFPSKEAAISVYAALYVAMYITCSVKAKGTRLAKPVLSLGLMCLAFLTGINRVVEYRNHWADVI 242

  Fly   272 SGSLLGVAGALITAHYIARMF 292
            :|.::|.|.|:.....:.:.|
Zfish   243 AGFIIGGAIAVFMVVCVVKNF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 48/156 (31%)
plppr5aNP_001121841.1 PAP2_wunen 107..256 CDD:239479 51/171 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.