DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11426 and sgpp1b

DIOPT Version :9

Sequence 1:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_001343219.1 Gene:sgpp1b / 100003745 ZFINID:ZDB-GENE-090319-2 Length:437 Species:Danio rerio


Alignment Length:169 Identity:38/169 - (22%)
Similarity:53/169 - (31%) Gaps:63/169 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ELGRQSTYFCFGLLLTFDATEVGKYTIGRL-----RPHFLAVCQ------PQIADGSMCSDPVNL 183
            |||.:..|..|   ..|....|..|...||     ...:|..|.      |:.|     |.||  
Zfish   133 ELGNELFYISF---FPFFMWNVDAYVSRRLVVVWVWVMYLGQCTKDVFRWPRPA-----SPPV-- 187

  Fly   184 HRYMENYDCAGEGFTVEDVRQARLSFPSGHS------SLAFYAMIY------VALYLQRKITWRG 236
                         ..||....:..|.||.|:      .|:.:.:.|      :.|.|...|:|  
Zfish   188 -------------VKVEMFYNSEYSMPSTHAMSGTAIPLSLFLLTYGRWEYPMLLGLSLAISW-- 237

  Fly   237 SKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSL 275
                       .|:|    .|||:....|...|:::|.|
Zfish   238 -----------CVLV----CLSRIYMGMHSILDIIAGFL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 38/169 (22%)
sgpp1bXP_001343219.1 PgpB 109..280 CDD:223743 38/169 (22%)
PAP2_SPPase1 122..270 CDD:239482 38/169 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.