DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11437 and Dolpp1

DIOPT Version :10

Sequence 1:NP_649393.1 Gene:CG11437 / 40470 FlyBaseID:FBgn0037165 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_065062.1 Gene:Dolpp1 / 57170 MGIID:1914093 Length:238 Species:Mus musculus


Alignment Length:133 Identity:31/133 - (23%)
Similarity:46/133 - (34%) Gaps:30/133 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 AASQDLLALVRHSF----PSGFVST---TCYAM-----GFLIFYSQARLFAPWLR---------- 221
            |.:|.:..|::|..    |.|...|   |.|.|     .|:.|:|.......:||          
Mouse    67 ALNQGVNWLIKHVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFL 131

  Fly   222 --LVRASLQLACCSLALVVCWERISTYQNHLTDVAAGAALGGWMAFFATVFVAHLFVEVRVKRRP 284
              |.|..|.|...:.|.:|.:.|:....:..:.|..|...|..||      ||...:...:....
Mouse   132 DLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGSLMA------VAWFIITQEILTPL 190

  Fly   285 MPR 287
            .||
Mouse   191 FPR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11437NP_649393.1 PAP2_wunen 109..268 CDD:239479 27/112 (24%)
Dolpp1NP_065062.1 PAP2_dolichyldiphosphatase 16..180 CDD:239477 29/118 (25%)

Return to query results.
Submit another query.