DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11437 and sgpp1a

DIOPT Version :10

Sequence 1:NP_649393.1 Gene:CG11437 / 40470 FlyBaseID:FBgn0037165 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_684347.1 Gene:sgpp1a / 556439 ZFINID:ZDB-GENE-030131-4695 Length:436 Species:Danio rerio


Alignment Length:71 Identity:22/71 - (30%)
Similarity:33/71 - (46%) Gaps:9/71 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LTKVHLTIAVVALPAA---FVLVVEMLRAAVVPSSTELTQRFVFVGVRIPRFISECYKAIGVYLF 119
            |..|...:.|||:|.|   |.:..:.:|.|...:..||..||:..|.     ::.|...:...||
Zfish   371 LLAVRAAMKVVAIPLACKIFGVPSDDVRKARQHAQVELAYRFLVYGT-----VAYCCVCLVPLLF 430

  Fly   120 G-LGLT 124
            | |||:
Zfish   431 GLLGLS 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11437NP_649393.1 PAP2_wunen 109..268 CDD:239479 7/17 (41%)
sgpp1aXP_684347.1 PAP2_SPPase1 121..270 CDD:239482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.