DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11438 and ynbD

DIOPT Version :10

Sequence 1:NP_649392.1 Gene:CG11438 / 40469 FlyBaseID:FBgn0037164 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_415929.1 Gene:ynbD / 945985 ECOCYCID:G6730 Length:430 Species:Escherichia coli


Alignment Length:116 Identity:24/116 - (20%)
Similarity:44/116 - (37%) Gaps:39/116 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 ANMTDYQFKEL------YQSFPSGHASMAMYAMLYLAIYLQAALSTRVSKLLKHLLQFLF----- 221
            :.:|.:.|.:|      |...||.|..:...                   |.:|..|.|.     
E. coli   110 SGVTGWLFSQLELFDLPYNQSPSLHIILCWL-------------------LWRHFRQHLAERWRK 155

  Fly   222 VMFGWY--VSLTRIIDYYHHWSDVLAGAALGVVFAWLTSAYVADLFAGKRW 270
            |..||:  ::::.:..:.||:.||:.|.|:|::..|:..       ..:||
E. coli   156 VCGGWFLLIAISTLTTWQHHFIDVITGLAVGMLIDWMVP-------VDRRW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11438NP_649392.1 PAP2_wunen 104..257 CDD:239479 22/101 (22%)
ynbDNP_415929.1 PAP2_Aur1_like 47..197 CDD:239481 22/112 (20%)
DSP_bac 295..429 CDD:350376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.