DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11438 and CAX4

DIOPT Version :10

Sequence 1:NP_649392.1 Gene:CG11438 / 40469 FlyBaseID:FBgn0037164 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_011550.3 Gene:CAX4 / 852924 SGDID:S000003268 Length:239 Species:Saccharomyces cerevisiae


Alignment Length:70 Identity:13/70 - (18%)
Similarity:32/70 - (45%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PSGHASMAMYAMLYLAIYLQAALSTRVSKLLKHLLQFLFVMFGWYVSLTRIIDYYHHWSDVLAGA 247
            ||.|:....:...|.::.:..:.. .::.|.|.:......:..:.|..:|:..:||:...|:.|.
Yeast   105 PSAHSQFMGFCFTYNSLKIYTSWK-NLNFLEKCIFSGALALLSFCVCFSRVYLHYHNLDQVIVGF 168

  Fly   248 ALGVV 252
            ::|.:
Yeast   169 SVGAL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11438NP_649392.1 PAP2_wunen 104..257 CDD:239479 13/70 (19%)
CAX4NP_011550.3 PAP2_dolichyldiphosphatase 17..179 CDD:239477 13/70 (19%)

Return to query results.
Submit another query.