DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11438 and LPPepsilon2

DIOPT Version :10

Sequence 1:NP_649392.1 Gene:CG11438 / 40469 FlyBaseID:FBgn0037164 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001331932.1 Gene:LPPepsilon2 / 836777 AraportID:AT5G66450 Length:308 Species:Arabidopsis thaliana


Alignment Length:89 Identity:24/89 - (26%)
Similarity:40/89 - (44%) Gaps:6/89 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PSGHASMAMYAMLYLAIYLQAALSTRVSKLLKHLLQFLFVMFGWYVSLTRIIDYYHHWSDVLAGA 247
            ||.||....:..::....:...|.|.|..|   .|....:..|.|.:..|:....|..|.|:.||
plant   169 PSSHAQSISFISVFSVFSVMEWLGTNVLSL---FLSGFILALGSYFTWLRVSQKLHTTSQVVVGA 230

  Fly   248 ALGVVFAWL--TSAYVADLFAGKR 269
            .:|.|::.|  |:| |:::.:..|
plant   231 IVGSVYSTLCVTNA-VSEVGSSSR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11438NP_649392.1 PAP2_wunen 104..257 CDD:239479 20/75 (27%)
LPPepsilon2NP_001331932.1 PAP2_dolichyldiphosphatase 99..240 CDD:239477 19/73 (26%)

Return to query results.
Submit another query.