DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11438 and LPPepsilon1

DIOPT Version :10

Sequence 1:NP_649392.1 Gene:CG11438 / 40469 FlyBaseID:FBgn0037164 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_190661.2 Gene:LPPepsilon1 / 824256 AraportID:AT3G50920 Length:279 Species:Arabidopsis thaliana


Alignment Length:77 Identity:21/77 - (27%)
Similarity:31/77 - (40%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PSGHASMAMYAMLYLAIYLQAALSTRVSKLLKHLLQFLFVMFGWYVSLTRIIDYYHHWSDVLAGA 247
            ||.||....:..::..:.:...|.|....|   .|..|.:..|.|....|:....|..|.|:.||
plant   162 PSSHAQSISFISVFAVLSVMEWLGTNGVSL---FLSGLILALGSYFIRLRVSQKLHTSSQVVVGA 223

  Fly   248 ALGVVFA--WLT 257
            .:|.:|.  |.|
plant   224 IVGSLFCILWYT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11438NP_649392.1 PAP2_wunen 104..257 CDD:239479 20/75 (27%)
LPPepsilon1NP_190661.2 PAP2_dolichyldiphosphatase 100..234 CDD:239477 19/74 (26%)

Return to query results.
Submit another query.