DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11438 and Plppr4

DIOPT Version :10

Sequence 1:NP_649392.1 Gene:CG11438 / 40469 FlyBaseID:FBgn0037164 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_808332.3 Gene:Plppr4 / 229791 MGIID:106530 Length:766 Species:Mus musculus


Alignment Length:64 Identity:12/64 - (18%)
Similarity:27/64 - (42%) Gaps:12/64 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PMLPSDALDPSVFY--VPNVYQQPYYYGYGSD----------YTGYTNSESVDMTSGAYGENAS 110
            |....:.:||.:.|  .|.::...|:.||.:.          |:.:.::..|.::...:..|:|
Mouse   268 PFFLCNLIDPFIGYSVPPLLFDLFYWIGYYNSTCNPIVYAFFYSWFRHAFRVILSKAIFQTNSS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11438NP_649392.1 PAP2_wunen 104..257 CDD:239479 2/7 (29%)
Plppr4NP_808332.3 PAP2_wunen 175..324 CDD:239479 10/55 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..494
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 672..701
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 742..766
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.