DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11438 and SGPP2

DIOPT Version :10

Sequence 1:NP_649392.1 Gene:CG11438 / 40469 FlyBaseID:FBgn0037164 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_689599.2 Gene:SGPP2 / 130367 HGNCID:19953 Length:399 Species:Homo sapiens


Alignment Length:121 Identity:33/121 - (27%)
Similarity:47/121 - (38%) Gaps:34/121 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PSGHASMAMYAMLYLAIYLQAALSTRVSKLLKHLLQFLF-----VMFGWYVSLTRIIDYYHHWSD 242
            ||.|| ||..|:         |.:..:|.:.::...|:.     |:|...|.|:|:....|...|
Human   163 PSTHA-MAATAI---------AFTLLISTMDRYQYPFVLGLVMAVVFSTLVCLSRLYTGMHTVLD 217

  Fly   243 VLAG---AALGVVF---AW-----LTSA--------YVADLFAGKRWPKTGYSANT 279
            ||.|   .||.:|.   ||     |.||        .|...|....:|.:.|.:.|
Human   218 VLGGVLITALLIVLTYPAWTFIDCLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11438NP_649392.1 PAP2_wunen 104..257 CDD:239479 25/89 (28%)
SGPP2NP_689599.2 PAP2_SPPase1 84..233 CDD:239482 23/79 (29%)
Phosphatase sequence motif I. /evidence=ECO:0000305 136..144
Phosphatase sequence motif II. /evidence=ECO:0000305 163..166 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000305 206..217 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.