DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and LPP1

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_010791.3 Gene:LPP1 / 852114 SGDID:S000002911 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:149 Identity:47/149 - (31%)
Similarity:64/149 - (42%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNNNLSTRQIRELHVSFPSAH 144
            |...|..:|.|||.|...|.|   |....||..:....::....||..:....::    |.||.|
Yeast   132 TGALKLIIGNLRPDFVDRCIP---DLQKMSDSDSLVFGLDICKQTNKWILYEGLK----STPSGH 189

  Fly   145 SSLSFYSMVLLALYVHGVWRGRGGVRVLRHVLQFLLLMAALCVSLSRVADYWHHWSDVLAGALLG 209
            ||....:|....|     |:.....|..|..:...||  ||.|.:|||.|:.|||.||::||:|.
Yeast   190 SSFIVSTMGFTYL-----WQRVFTTRNTRSCIWCPLL--ALVVMVSRVIDHRHHWYDVVSGAVLA 247

  Fly   210 --VTYAAITAAYVGNLLRR 226
              |.|......:. ||.:|
Yeast   248 FLVIYCCWKWTFT-NLAKR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 44/138 (32%)
LPP1NP_010791.3 PAP2_containing_1_like 52..258 CDD:239484 44/139 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 1 1.000 - - X622
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.