DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and PLPP5

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_024303075.1 Gene:PLPP5 / 84513 HGNCID:25026 Length:342 Species:Homo sapiens


Alignment Length:215 Identity:61/215 - (28%)
Similarity:93/215 - (43%) Gaps:42/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RGFFCSDLSIRYPYKDCTITVPMLLLMMLLLPMLFVAVVEIMRICKRFRTRLYFRNLWRAEATFS 70
            ||..|    :.:|      ....::..:..|.::|:|         :|..:...|:..:|....|
Human   127 RGHLC----VFHP------ETAFVIAFLSPLSLIFLA---------KFLKKADTRDSRQACLAAS 172

  Fly    71 FGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNNNLSTRQIRE 135
            .......:.|...|..|||.||.||:.|.|   ||.:.|||.          ||.:.   ..:.|
Human   173 LALALNGVFTNTIKLIVGRPRPDFFYRCFP---DGLAHSDLM----------CTGDK---DVVNE 221

  Fly   136 LHVSFPSAHSSLSFYSMVLLALYVHG-----VWRGRGGVRVLRHVLQFLLLMAALCVSLSRVADY 195
            ...||||.|||.:|..:...:.|:.|     ..:|||  :..|.......|:.|..::|||..||
Human   222 GRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRG--KSWRFCAFLSPLLFAAVIALSRTCDY 284

  Fly   196 WHHWSDVLAGALLGVTYAAI 215
            .|||.|||.|:::|:|:|.:
Human   285 KHHWQDVLVGSMIGMTFAYV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 52/159 (33%)
PLPP5XP_024303075.1 PAP2_containing_1_like 92..309 CDD:239484 61/215 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144687
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2488
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.