DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and Plppr5

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001292380.1 Gene:Plppr5 / 75769 MGIID:1923019 Length:321 Species:Mus musculus


Alignment Length:267 Identity:77/267 - (28%)
Similarity:117/267 - (43%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RGFFCSDLSIRYPY---KDCTITVPMLLLMMLL-LPMLFVAVVEIMRICKRFRTR---------- 56
            :||||.|.:.|.||   :|.:...|:||..:.. :|:|.:.|.|....|.:..||          
Mouse    41 QGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTIL 105

  Fly    57 ----LYFRNLWRAEATF----SFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQN 113
                .|...|.|....|    :||..||.:.....:...|.|.|||...|:|.. ....|.  |.
Mouse   106 TGDCCYINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNY-TALGCQ--QY 167

  Fly   114 AELYVEQFHCTNNNLSTRQIRELHVSFPSAHSSLSFYSMVLLALYVHGVWRGRGGVRVLRHVLQF 178
            .:....:..||.|.....:.|:   :|||..::||.|:...|.:|:....:.: |.|:.:.||..
Mouse   168 TQFISGEEACTGNPDLIMRARK---TFPSKEAALSVYAATYLTMYITSTIKAK-GTRLAKPVLCL 228

  Fly   179 LLLMAALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAYVGNLLRRQTSSTGRIPPSLNYSHH 243
            .|:..|....|:|||:|.:|||||:||.|:|::.|......|.|..:      ||.|.    :.|
Mouse   229 GLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFK------GRQPE----NGH 283

  Fly   244 LHHQLMA 250
            :|...:|
Mouse   284 IHRDNVA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 49/158 (31%)
Plppr5NP_001292380.1 PAP2_wunen 118..267 CDD:239479 47/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834771
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.