DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and Plpp5

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_082276.1 Gene:Plpp5 / 71910 MGIID:1919160 Length:260 Species:Mus musculus


Alignment Length:227 Identity:66/227 - (29%)
Similarity:93/227 - (40%) Gaps:68/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MLFVAVVEIMRICKRFRTRLYFRNLW-----RAEATF---------------SFGFIATYLT--- 79
            :||||.: :..:...|:.|:....||     ..||.:               |..|:|.:|.   
Mouse    15 LLFVAFL-VTELLPPFQRRIQPEELWLYRNPYVEAEYFPTGRMFVIAFLTPLSLIFLAKFLRKAD 78

  Fly    80 ---------------------TELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHC 123
                                 |.:.|..|||.||.||:.|.|   ||.:.|||.          |
Mouse    79 ATDSKQACLAASLALALNGVFTNIIKLIVGRPRPDFFYRCFP---DGLAHSDLT----------C 130

  Fly   124 TNNNLSTRQIRELHVSFPSAHSSLSFYSMVLLALYVHG-----VWRGRGGVRVLRHVLQFLLLMA 183
            |.:.   ..:.|...||||.|||.:|..:...:.|:.|     ..:|||....|...|..||..|
Mouse   131 TGDE---DVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRLCAFLSPLLFAA 192

  Fly   184 ALCVSLSRVADYWHHWSDVLAGALLGVTYAAI 215
            .  ::|||..||.|||.|||.|:::|:|:|.:
Mouse   193 V--IALSRTCDYKHHWQDVLVGSMIGMTFAYV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 60/203 (30%)
Plpp5NP_082276.1 PAP2_containing_1_like 39..227 CDD:239484 59/202 (29%)
Phosphatase sequence motif I. /evidence=ECO:0000250|UniProtKB:Q8NEB5 104..112 4/7 (57%)
Phosphatase sequence motif II. /evidence=ECO:0000250|UniProtKB:Q8NEB5 145..148 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000250|UniProtKB:Q8NEB5 197..207 6/9 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2488
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 1 1.000 - - X622
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.