DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and Plpp5

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_017455732.1 Gene:Plpp5 / 680466 RGDID:1591734 Length:316 Species:Rattus norvegicus


Alignment Length:210 Identity:62/210 - (29%)
Similarity:89/210 - (42%) Gaps:50/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YKDCTITVPMLLLMMLLLPMLFVAVVEIMRICKRFRTRLYFRNLWRAEAT--------FSFGFIA 75
            |..|.    :|.::..|.|:..:...:.:|               :|:||        .|.....
  Rat   106 YLSCA----LLQVIAFLTPLSLIFFAKFLR---------------KADATDSKQACLAASLALAL 151

  Fly    76 TYLTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNNNLSTRQIRELHVSF 140
            ..:.|.:.|..|||.||.||:.|.|   ||.:.|||.          ||.:.   ..:.|...||
  Rat   152 NGVFTNIIKLIVGRPRPDFFYRCFP---DGMAHSDLT----------CTGDK---DVVNEGRKSF 200

  Fly   141 PSAHSSLSFYSMVLLALYVHG-----VWRGRGGVRVLRHVLQFLLLMAALCVSLSRVADYWHHWS 200
            ||.|||.:|..:...:.|:.|     ..:|||....|...|..||..|.  ::|||..||.|||.
  Rat   201 PSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRLCAFLSPLLFAAV--IALSRTCDYKHHWQ 263

  Fly   201 DVLAGALLGVTYAAI 215
            |||.|:::|.|:|.:
  Rat   264 DVLVGSMIGTTFAYV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 56/167 (34%)
Plpp5XP_017455732.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338381
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X622
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.