DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and DOLPP1

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_065171.2 Gene:DOLPP1 / 57171 HGNCID:29565 Length:238 Species:Homo sapiens


Alignment Length:222 Identity:59/222 - (26%)
Similarity:77/222 - (34%) Gaps:59/222 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IRYPYKDCTITVPMLLLMMLLLPMLFVAVVEIMRICKRFRTRLYFRNLWRAEATFSF--GFIATY 77
            :.||..|    :...||..|.|..:||.|        .|.|.:.|:   |...|.||  |.....
Human    21 VEYPAGD----LSGHLLAYLSLSPVFVIV--------GFVTLIIFK---RELHTISFLGGLALNE 70

  Fly    78 LTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNNNLSTRQIRELHVSFPS 142
            ....|.|:.:...||               |.....|             :.|:      ...||
Human    71 GVNWLIKNVIQEPRP---------------CGGPHTA-------------VGTK------YGMPS 101

  Fly   143 AHSS----LSFYSMVLLALYVHGVWRGRGGVRVLRHVLQFLLLMAALCVSLSRVADYWHHWSDVL 203
            :||.    .|.||.:.|.|.:|.....|....:.||||...||..|..||.|||...:|.||.||
Human   102 SHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVL 166

  Fly   204 ----AGALLGVTYAAITAAYVGNLLRR 226
                ||.|:.:.:...|...:..|..|
Human   167 YGGIAGGLMAIAWFIFTQEVLTPLFPR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 43/164 (26%)
DOLPP1NP_065171.2 PAP2_dolichyldiphosphatase 16..180 CDD:239477 56/207 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.