DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and plppr4a

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_005163404.1 Gene:plppr4a / 559888 ZFINID:ZDB-GENE-070705-280 Length:775 Species:Danio rerio


Alignment Length:262 Identity:60/262 - (22%)
Similarity:106/262 - (40%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRGFFCSDLSIRYPYKDCT-ITVPMLLLMMLLL--PMLFVAVVEIMRICKRFRTRL--------- 57
            :.|:.|:|.|:..||.:.| ..:|.|:|..|..  |.:.:.:.|.:..|...|..:         
Zfish    50 RSGYSCNDRSLSMPYIEPTKEVIPFLMLFSLAFAGPAVTIMIGEGILYCCVARRNIAIKTEANIN 114

  Fly    58 --------YFRNLWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDD-GSSCSDLQN 113
                    |.|...|......||...|.|.|::.:.|.|...|:|...|:|.... ..||.:   
Zfish   115 AAGCNFNSYIRRAVRFVGVHVFGLCITALITDIIQLATGYHAPYFLTVCKPNYTTLNISCDE--- 176

  Fly   114 AELYVEQFHCTNNNLSTRQIRELHVSFPSAHSSLSFYSMVLLALYVHGVWRGRGGVRVLRHVLQF 178
             ..::....|:..:.:.  |.....||||.|::|:.::.|.:::|.:.......  ::|:.:|.|
Zfish   177 -NSFIVDDICSGPDPAA--INSGRKSFPSQHATLAAFAAVYISMYFNATLTDSS--KLLKPLLVF 236

  Fly   179 LLLMAALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAYVGNLLRRQTSSTGRIPPSLNYSHH 243
            ..::..:...|:|:..:.:|..||..|.|||...|.....|          :.|...||.:.|..
Zfish   237 SFIICGIICGLTRIIQFKNHAVDVYCGFLLGGGIAIYLGLY----------AVGNFKPSEDTSLR 291

  Fly   244 LH 245
            :|
Zfish   292 IH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 37/155 (24%)
plppr4aXP_005163404.1 PAP2_wunen 126..275 CDD:239479 37/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.