DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and plpp2b

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_956247.1 Gene:plpp2b / 335485 ZFINID:ZDB-GENE-030131-7425 Length:273 Species:Danio rerio


Alignment Length:261 Identity:81/261 - (31%)
Similarity:121/261 - (46%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HTFKRGFFCSDLSIRYPYKDCTITVPMLLLMMLLLPMLFVA-----VVEIMRICKRFRTRLYFRN 61
            |.::||.||.|.||.||.|..|||...|..:.:...:|.:.     :|...:|........|...
Zfish    30 HPYERGIFCQDESIGYPVKTDTITNVTLAAVTITCTILIICSGEAYLVYSKKIHSNSSFNQYVSA 94

  Fly    62 LWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNN 126
            :::....|.||...:...|:|||:.:||.||:|...|.|::..|           :|...:||.|
Zfish    95 IYKVLGAFLFGGAVSQSLTDLAKYTIGRPRPNFLAVCAPKVCKG-----------FVNLNNCTGN 148

  Fly   127 NLSTRQIRELHVSFPSAHSSLSFYSMVLLALYV----HGVWRGRGGVRVLRHVLQFLLLMAALCV 187
               ...:.|..:||.|.|||.:.|.|:.||.||    :..|     .|:||..:||.|:..|:.|
Zfish   149 ---PADVTEARLSFYSGHSSFAMYCMLFLAFYVQARLNAKW-----ARLLRPTIQFFLVAFAVYV 205

  Fly   188 SLSRVADYWHHWSDVLAGALLGVTYAAITAAYVGNLLRRQTSSTGRIPPSLNYSHHLHHQLMADN 252
            ..:||:||.||||||:.|.|.|...|.:|..:|.|..:...|     |...|..:.::.:....|
Zfish   206 GYTRVSDYKHHWSDVMVGLLQGALIAILTVRFVSNFFKVSPS-----PECSNQENAVNEERKPSN 265

  Fly   253 N 253
            :
Zfish   266 S 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 55/158 (35%)
plpp2bNP_956247.1 PAP2_wunen 94..235 CDD:239479 55/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.