DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and Plpp4

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038934456.1 Gene:Plpp4 / 309014 RGDID:1306289 Length:273 Species:Rattus norvegicus


Alignment Length:269 Identity:69/269 - (25%)
Similarity:105/269 - (39%) Gaps:72/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YKDCTI---TVPMLLLMML--LLPMLFVAVVEIMRICKRFRTRLYFRNLWRAEATFSFGFIATYL 78
            ||:..:   .:|..|:..:  |.|:..:.||:|:|...:...:..|        ..|.......:
  Rat    39 YKNPLVQSDNIPTRLMFAISFLTPLAVICVVKIIRRTDKTEIKEAF--------LVSLALALNGV 95

  Fly    79 TTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNNNLSTRQIRELHVSFPSA 143
            .|...|..|||.||.||:.|.|   ||     :.|:|:     |||.:   ...:.|...||||.
  Rat    96 CTNTIKLIVGRPRPDFFYRCFP---DG-----VMNSEM-----HCTGD---PDLVSEGRKSFPSI 144

  Fly   144 HSSLSFYSMVLLALYVHG-----VWRGRGGVRVLRHVLQFLLLMAALCVSLSRVADYWHHWSDVL 203
            |||.:|..:.....|:.|     ...|||  :..|.....|.|..|:.::|||:.||.|||..| 
  Rat   145 HSSFAFSGLGFTTFYLAGKLHCFTESGRG--KSWRLCAAILPLYCAMMIALSRMCDYKHHWQAV- 206

  Fly   204 AGALLGVTYAAITAAYVGNLLRRQTSSTGRIPPSLNYSHHLHHQLMADNNNSTASAKVHFLAAAA 268
                      |:|.             :.|..|||:...  .|||:..::          :..::
  Rat   207 ----------AVTV-------------SRRAVPSLHVKE--VHQLLCPDS----------ILGSS 236

  Fly   269 SASMTTTTP 277
            ...:.||.|
  Rat   237 EQQLITTCP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 47/159 (30%)
Plpp4XP_038934456.1 PAP2_containing_1_like 37..206 CDD:239484 56/192 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.