DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment laza and Plppr1

DIOPT Version :9

Sequence 1:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_958428.2 Gene:Plppr1 / 298062 RGDID:1303116 Length:325 Species:Rattus norvegicus


Alignment Length:314 Identity:81/314 - (25%)
Similarity:126/314 - (40%) Gaps:68/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TFK---RGFFCSDLSIRYPY----KDCTITVPMLLLMMLLLPMLFVAVVEI-MRICKRFRTRL-- 57
            ||:   :||||.|..:..||    ::..|:..:|..::...|...:.:.|| |...|..|..|  
  Rat    40 TFQVHIQGFFCQDGDLMKPYPGTEEESFISPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIA 104

  Fly    58 ---------------YFRNLWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGSS 107
                           ..|.:.|....|:||..||.:.....:...|.|.|:|...|||..    :
  Rat   105 EEKMILTGDCCYLSPLLRRIVRFIGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCQPNY----T 165

  Fly   108 CSDLQNAELYVEQFHCTNNNLST---RQIRELHVSFPSAHSSLSFYSMVLLALYVHGVWRGRGGV 169
            .:|.:....::     .|.|:.|   ..|.:...||||.|::||.||.:...:|:....:.:.. 
  Rat   166 STDCRAHHQFI-----NNGNICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSS- 224

  Fly   170 RVLRHVLQFLLLMAALCVSLSRVADYWHHWSDVLAGALLGVTYAAITAAYV--------GNLLRR 226
            |:.:.||....|..|....|:||::|.:|.|||:||.:||...|......|        |:..:.
  Rat   225 RLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSASKP 289

  Fly   227 QTSSTGRIPPSLNYSHHLHHQLMA----DNNNSTASAKVHFLAAAASASMTTTT 276
            :......:|            |||    ::...|.||:.|      |||||..|
  Rat   290 KPEDPRGVP------------LMAFPRIESPLETLSAQNH------SASMTEVT 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 46/157 (29%)
Plppr1NP_958428.2 PAP2_wunen 123..272 CDD:239479 46/158 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338346
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.